PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0365s0200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 292aa    MW: 33377.9 Da    PI: 7.217
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0365s0200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.84.4e-5381321128
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                             lppGfrFhPtdeelv +yL++k++++++++  +i+e+d+yk++PwdLp ++  +ekewyfF++rd+ky++g+r+nra+ +gyWkatg
  SapurV1A.0365s0200.1.p   8 LPPGFRFHPTDEELVLHYLCRKCSSQRIDV-PIIAEIDLYKFDPWDLPGMALYGEKEWYFFTPRDRKYPNGSRPNRAAGRGYWKATG 93 
                             79****************************.88***************6666689******************************** PP

                     NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              dk++ +   ++vg+kk Lvfy g+apkgekt+W+mheyrl
  SapurV1A.0365s0200.1.p  94 ADKPIGQ--PKTVGIKKALVFYAGKAPKGEKTNWIMHEYRL 132
                             *****98..778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.19E-624158IPR003441NAC domain
PROSITE profilePS5100560.4498158IPR003441NAC domain
PfamPF023657.1E-289132IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009611Biological Processresponse to wounding
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MTATTLELPP GFRFHPTDEE LVLHYLCRKC SSQRIDVPII AEIDLYKFDP WDLPGMALYG  60
EKEWYFFTPR DRKYPNGSRP NRAAGRGYWK ATGADKPIGQ PKTVGIKKAL VFYAGKAPKG  120
EKTNWIMHEY RLADVDRSAR KKNSLRLDDW VLCRIYNKKG TIEKQEQHLS VKKVNPAEIE  180
EDEKKQVVLL PPPAAPSAAT GTVNDYMYFD TSDSVPRLHT DSSCSEHVVS PEFTCEVQSE  240
PRWKEWGNVN ALDNHYNYLD ATMDIPFASQ LQGGYQMSPL QDIFMHLQKP F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-83616413174Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00121DAPTransfer from AT1G01720Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU2279790.0CU227979.1 Populus EST from severe drought-stressed leaves.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002300972.10.0no apical meristem family protein
SwissprotQ390131e-145NAC2_ARATH; NAC domain-containing protein 2
TrEMBLB9GU140.0B9GU14_POPTR; No apical meristem family protein
STRINGPOPTR_0002s08150.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF125834108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.11e-144NAC family protein